Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1971270..1972101 Replicon chromosome
Accession NZ_LS992190
Organism Escherichia coli isolate Escherichia coli str. TO148

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag ECTO148_RS09470 Protein ID WP_000854815.1
Coordinates 1971270..1971644 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag ECTO148_RS09475 Protein ID WP_001280918.1
Coordinates 1971733..1972101 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO148_RS09430 1966666..1967832 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
ECTO148_RS09435 1967951..1968424 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
ECTO148_RS09440 1968622..1969680 + 1059 WP_001200889.1 FUSC family protein -
ECTO148_RS09445 1969852..1970181 + 330 WP_000450409.1 DUF496 family protein -
ECTO148_RS09450 1970282..1970464 - 183 WP_001296208.1 hypothetical protein -
ECTO148_RS09455 1970518..1970664 + 147 Protein_1805 transposase domain-containing protein -
ECTO148_RS09460 1970953..1971066 - 114 WP_001161660.1 DUF957 domain-containing protein -
ECTO148_RS09465 1971079..1971273 - 195 WP_000988600.1 hypothetical protein -
ECTO148_RS09470 1971270..1971644 - 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
ECTO148_RS09475 1971733..1972101 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO148_RS09480 1972117..1972761 - 645 WP_000086752.1 hypothetical protein -
ECTO148_RS09485 1972780..1973001 - 222 WP_000692345.1 DUF987 domain-containing protein -
ECTO148_RS09490 1973064..1973540 - 477 WP_134161670.1 RadC family protein -
ECTO148_RS09495 1973556..1974029 - 474 WP_001542276.1 antirestriction protein -
ECTO148_RS09500 1974123..1974368 - 246 WP_001164966.1 hypothetical protein -
ECTO148_RS09505 1974368..1975186 - 819 WP_001542275.1 DUF945 domain-containing protein -
ECTO148_RS09515 1975407..1975817 - 411 WP_000846703.1 hypothetical protein -
ECTO148_RS09520 1975833..1976183 - 351 Protein_1817 hypothetical protein -
ECTO148_RS09530 1976266..1977012 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T292918 WP_000854815.1 NZ_LS992190:c1971644-1971270 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT292918 WP_001280918.1 NZ_LS992190:c1972101-1971733 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References