Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 890690..891524 | Replicon | chromosome |
| Accession | NZ_LS992190 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO148 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IX31 |
| Locus tag | ECTO148_RS04355 | Protein ID | WP_000854689.1 |
| Coordinates | 890690..891067 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1X3JHN3 |
| Locus tag | ECTO148_RS04360 | Protein ID | WP_001285598.1 |
| Coordinates | 891144..891524 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO148_RS04325 | 887070..887240 | - | 171 | Protein_834 | IS110 family transposase | - |
| ECTO148_RS04330 | 887711..888604 | - | 894 | WP_001114681.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| ECTO148_RS04335 | 888597..888992 | - | 396 | WP_000208383.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
| ECTO148_RS04340 | 889061..889906 | - | 846 | WP_023281696.1 | DUF4942 domain-containing protein | - |
| ECTO148_RS04345 | 889991..890188 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| ECTO148_RS04350 | 890205..890693 | - | 489 | WP_000761699.1 | hypothetical protein | - |
| ECTO148_RS04355 | 890690..891067 | - | 378 | WP_000854689.1 | TA system toxin CbtA family protein | Toxin |
| ECTO148_RS04360 | 891144..891524 | - | 381 | WP_001285598.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO148_RS04365 | 891574..892218 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| ECTO148_RS04370 | 892237..892458 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| ECTO148_RS04375 | 892521..892997 | - | 477 | WP_001186726.1 | RadC family protein | - |
| ECTO148_RS04380 | 893013..893498 | - | 486 | WP_000849566.1 | antirestriction protein | - |
| ECTO148_RS04385 | 893553..894371 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
| ECTO148_RS04395 | 894472..894681 | - | 210 | WP_032142237.1 | DUF905 family protein | - |
| ECTO148_RS04400 | 894786..895241 | - | 456 | WP_000581502.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14042.07 Da Isoelectric Point: 9.1510
>T292915 WP_000854689.1 NZ_LS992190:c891067-890690 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13927.72 Da Isoelectric Point: 4.7959
>AT292915 WP_001285598.1 NZ_LS992190:c891524-891144 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|