Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 45960..46795 Replicon chromosome
Accession NZ_LS992190
Organism Escherichia coli isolate Escherichia coli str. TO148

Toxin (Protein)


Gene name yeeV Uniprot ID A0A376WVB1
Locus tag ECTO148_RS00240 Protein ID WP_001094448.1
Coordinates 45960..46337 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3T7EC32
Locus tag ECTO148_RS00245 Protein ID WP_024175935.1
Coordinates 46427..46795 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO148_RS00210 41328..42146 + 819 WP_000779409.1 lipoprotein NlpA -
ECTO148_RS00215 42150..43073 - 924 WP_000535950.1 carboxylate/amino acid/amine transporter -
ECTO148_RS00220 43251..43748 - 498 WP_000509815.1 hypothetical protein -
ECTO148_RS00225 44341..45186 - 846 WP_000065751.1 DUF4942 domain-containing protein -
ECTO148_RS00230 45242..45463 - 222 WP_001296561.1 DUF957 domain-containing protein -
ECTO148_RS00235 45475..45963 - 489 WP_000761714.1 hypothetical protein -
ECTO148_RS00240 45960..46337 - 378 WP_001094448.1 TA system toxin CbtA family protein Toxin
ECTO148_RS00245 46427..46795 - 369 WP_024175935.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO148_RS00250 46869..47090 - 222 WP_000692346.1 DUF987 domain-containing protein -
ECTO148_RS00255 47159..47368 - 210 Protein_50 hypothetical protein -
ECTO148_RS00260 47452..48198 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
ECTO148_RS00265 48213..49754 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
ECTO148_RS00270 49943..50221 - 279 Protein_53 hypothetical protein -
ECTO148_RS00275 50233..50718 - 486 WP_000214415.1 antirestriction protein -
ECTO148_RS00280 50810..51628 - 819 WP_001234753.1 DUF945 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14221.22 Da        Isoelectric Point: 8.2919

>T292910 WP_001094448.1 NZ_LS992190:c46337-45960 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13598.40 Da        Isoelectric Point: 6.6255

>AT292910 WP_024175935.1 NZ_LS992190:c46795-46427 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A376WVB1

Antitoxin

Source ID Structure
AlphaFold DB A0A3T7EC32

References