Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 64089..64648 Replicon plasmid 2
Accession NZ_LS992186
Organism Escherichia coli isolate Escherichia coli str. 3426

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag EC3426_RS24470 Protein ID WP_000421272.1
Coordinates 64089..64364 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag EC3426_RS24475 Protein ID WP_001387467.1
Coordinates 64364..64648 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC3426_RS24430 60150..60890 - 741 WP_001066942.1 tyrosine-type recombinase/integrase -
EC3426_RS24435 61011..61193 - 183 WP_050488504.1 hypothetical protein -
EC3426_RS24440 61260..61421 - 162 WP_001440647.1 type II toxin-antitoxin system RelE/ParE family toxin -
EC3426_RS24445 61537..61793 - 257 Protein_59 type II toxin-antitoxin system ParD family antitoxin -
EC3426_RS24455 62325..63494 + 1170 WP_001403369.1 hypothetical protein -
EC3426_RS24460 63527..63655 + 129 Protein_61 IS481 family transposase -
EC3426_RS24465 63690..63983 - 294 WP_001105060.1 hypothetical protein -
EC3426_RS24470 64089..64364 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EC3426_RS24475 64364..64648 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
EC3426_RS24480 65253..65720 + 468 Protein_65 IclR family transcriptional regulator -
EC3426_RS24485 65783..66487 + 705 WP_098986935.1 IS6-like element IS26 family transposase -
EC3426_RS24495 66653..66811 + 159 WP_000449408.1 DsbA family protein -
EC3426_RS24500 66801..67307 + 507 WP_000949451.1 protein disulfide oxidoreductase -
EC3426_RS24505 67365..68062 - 698 Protein_69 IS1-like element IS1A family transposase -
EC3426_RS24510 68266..69081 + 816 WP_012372823.1 Na(+)-translocating NADH-quinone reductase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..164477 164477
- flank IS/Tn - - 65783..66487 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T292894 WP_000421272.1 NZ_LS992186:c64364-64089 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT292894 WP_001387467.1 NZ_LS992186:c64648-64364 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References