Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 50184..50785 Replicon plasmid 2
Accession NZ_LS992186
Organism Escherichia coli isolate Escherichia coli str. 3426

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag EC3426_RS24365 Protein ID WP_001216034.1
Coordinates 50405..50785 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EC3426_RS24360 Protein ID WP_001190712.1
Coordinates 50184..50405 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC3426_RS24350 47165..48448 - 1284 WP_001553855.1 restriction endonuclease subunit S -
EC3426_RS24355 48445..50001 - 1557 WP_001553856.1 type I restriction-modification system subunit M -
EC3426_RS24360 50184..50405 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EC3426_RS24365 50405..50785 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EC3426_RS24370 50790..50969 + 180 WP_001513661.1 hypothetical protein -
EC3426_RS24375 50997..51356 + 360 WP_001513660.1 hypothetical protein -
EC3426_RS24380 51280..51693 + 414 Protein_47 DDE-type integrase/transposase/recombinase -
EC3426_RS24385 51643..51960 - 318 WP_001513659.1 hypothetical protein -
EC3426_RS24390 52188..53204 - 1017 WP_012372828.1 IS5-like element IS5 family transposase -
EC3426_RS24395 53412..54815 + 1404 WP_001373486.1 S-methylmethionine permease -
EC3426_RS24400 54802..55734 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..164477 164477


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T292893 WP_001216034.1 NZ_LS992186:50405-50785 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT292893 WP_001190712.1 NZ_LS992186:50184-50405 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References