Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 36763..37406 | Replicon | plasmid 2 |
Accession | NZ_LS992186 | ||
Organism | Escherichia coli isolate Escherichia coli str. 3426 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | EC3426_RS24315 | Protein ID | WP_001044768.1 |
Coordinates | 36990..37406 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | EC3426_RS24310 | Protein ID | WP_001261287.1 |
Coordinates | 36763..36993 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC3426_RS24295 | 31941..33074 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
EC3426_RS24300 | 33337..36456 | - | 3120 | WP_001553851.1 | hypothetical protein | - |
EC3426_RS24310 | 36763..36993 | + | 231 | WP_001261287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EC3426_RS24315 | 36990..37406 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EC3426_RS24320 | 37568..39706 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
EC3426_RS24325 | 40250..40947 | + | 698 | Protein_36 | IS1 family transposase | - |
EC3426_RS24330 | 40984..41943 | + | 960 | WP_133963875.1 | nucleotidyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..164477 | 164477 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T292892 WP_001044768.1 NZ_LS992186:36990-37406 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |