Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 30284..30809 | Replicon | plasmid 2 |
Accession | NZ_LS992186 | ||
Organism | Escherichia coli isolate Escherichia coli str. 3426 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | EC3426_RS24275 | Protein ID | WP_001159868.1 |
Coordinates | 30284..30589 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | EC3426_RS24280 | Protein ID | WP_000813634.1 |
Coordinates | 30591..30809 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC3426_RS24260 | 26194..27360 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
EC3426_RS24265 | 27948..28703 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
EC3426_RS24270 | 29477..30283 | - | 807 | WP_000016982.1 | site-specific integrase | - |
EC3426_RS24275 | 30284..30589 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
EC3426_RS24280 | 30591..30809 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
EC3426_RS24285 | 31443..31640 | + | 198 | WP_000215657.1 | hypothetical protein | - |
EC3426_RS24290 | 31637..31921 | - | 285 | WP_000642771.1 | hypothetical protein | - |
EC3426_RS24295 | 31941..33074 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..164477 | 164477 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T292891 WP_001159868.1 NZ_LS992186:c30589-30284 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|