Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4108273..4108927 | Replicon | chromosome |
| Accession | NZ_LS992185 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | EC3426_RS20115 | Protein ID | WP_000244781.1 |
| Coordinates | 4108273..4108680 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | EC3426_RS20120 | Protein ID | WP_000354046.1 |
| Coordinates | 4108661..4108927 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS20095 | 4104230..4105963 | - | 1734 | WP_021523238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EC3426_RS20100 | 4105969..4106679 | - | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EC3426_RS20105 | 4106704..4107600 | - | 897 | WP_060581628.1 | site-specific tyrosine recombinase XerD | - |
| EC3426_RS20110 | 4107712..4108233 | + | 522 | WP_001521233.1 | flavodoxin FldB | - |
| EC3426_RS20115 | 4108273..4108680 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| EC3426_RS20120 | 4108661..4108927 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| EC3426_RS20125 | 4109170..4110150 | + | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| EC3426_RS20130 | 4110227..4110886 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
| EC3426_RS20135 | 4111050..4111361 | - | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
| EC3426_RS20140 | 4111406..4112839 | + | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T292888 WP_000244781.1 NZ_LS992185:c4108680-4108273 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|