Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2476128..2476766 | Replicon | chromosome |
| Accession | NZ_LS992185 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | EC3426_RS12220 | Protein ID | WP_001447010.1 |
| Coordinates | 2476128..2476304 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EC3426_RS12225 | Protein ID | WP_001270286.1 |
| Coordinates | 2476350..2476766 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS12200 | 2471747..2472961 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
| EC3426_RS12205 | 2473014..2473550 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| EC3426_RS12210 | 2473623..2475584 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EC3426_RS12215 | 2475676..2475906 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| EC3426_RS12220 | 2476128..2476304 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EC3426_RS12225 | 2476350..2476766 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EC3426_RS12230 | 2476845..2478251 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| EC3426_RS12235 | 2478496..2479641 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| EC3426_RS12240 | 2479659..2480672 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| EC3426_RS12245 | 2480673..2481614 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T292878 WP_001447010.1 NZ_LS992185:2476128-2476304 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT292878 WP_001270286.1 NZ_LS992185:2476350-2476766 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|