Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1136764..1137458 | Replicon | chromosome |
| Accession | NZ_LS992185 | ||
| Organism | Escherichia coli isolate Escherichia coli str. 3426 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A1X9TDN4 |
| Locus tag | EC3426_RS05585 | Protein ID | WP_001094398.1 |
| Coordinates | 1137090..1137458 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EC3426_RS05580 | Protein ID | WP_077249034.1 |
| Coordinates | 1136764..1137069 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC3426_RS05535 | 1132714..1133169 | + | 456 | WP_000581506.1 | hypothetical protein | - |
| EC3426_RS05540 | 1133270..1133478 | + | 209 | Protein_1042 | DUF905 family protein | - |
| EC3426_RS05550 | 1133579..1134400 | + | 822 | WP_001234565.1 | DUF945 domain-containing protein | - |
| EC3426_RS05560 | 1134742..1135215 | + | 474 | WP_133963778.1 | antirestriction protein | - |
| EC3426_RS05565 | 1135231..1135707 | + | 477 | WP_001424026.1 | RadC family protein | - |
| EC3426_RS05570 | 1135776..1135997 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EC3426_RS05575 | 1136016..1136660 | + | 645 | WP_000086755.1 | hypothetical protein | - |
| EC3426_RS05580 | 1136764..1137069 | + | 306 | WP_077249034.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EC3426_RS05585 | 1137090..1137458 | + | 369 | WP_001094398.1 | TA system toxin CbtA family protein | Toxin |
| EC3426_RS05590 | 1137779..1138117 | - | 339 | Protein_1050 | LysR family transcriptional regulator | - |
| EC3426_RS05595 | 1138168..1139124 | - | 957 | WP_000121359.1 | molybdenum cofactor insertion chaperone PaoD | - |
| EC3426_RS05600 | 1139134..1141332 | - | 2199 | WP_000667026.1 | aldehyde oxidoreductase molybdenum-binding subunit PaoC | - |
| EC3426_RS05605 | 1141329..1142285 | - | 957 | WP_000643333.1 | aldehyde oxidoreductase FAD-binding subunit PaoB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1121105..1144003 | 22898 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13581.73 Da Isoelectric Point: 7.7465
>T292875 WP_001094398.1 NZ_LS992185:1137090-1137458 [Escherichia coli]
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|