Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4832791..4833407 | Replicon | chromosome |
Accession | NZ_LS992183 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. U2785 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | CFU2785_RS24130 | Protein ID | WP_003028682.1 |
Coordinates | 4832791..4833165 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | CFU2785_RS24135 | Protein ID | WP_043018956.1 |
Coordinates | 4833165..4833407 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFU2785_RS24115 | 4830294..4831196 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
CFU2785_RS24120 | 4831193..4831828 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
CFU2785_RS24125 | 4831825..4832754 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
CFU2785_RS24130 | 4832791..4833165 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CFU2785_RS24135 | 4833165..4833407 | - | 243 | WP_043018956.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CFU2785_RS24140 | 4833613..4834521 | + | 909 | WP_003847901.1 | alpha/beta hydrolase | - |
CFU2785_RS24150 | 4834672..4835613 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
CFU2785_RS24155 | 4835658..4836095 | - | 438 | WP_003028671.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
CFU2785_RS24160 | 4836092..4836964 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
CFU2785_RS24165 | 4836958..4837557 | - | 600 | WP_003028663.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T292864 WP_003028682.1 NZ_LS992183:c4833165-4832791 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |