Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeV-yafW/CbtA-CbeA
Location 4680792..4681585 Replicon chromosome
Accession NZ_LS992183
Organism Citrobacter freundii isolate Citrobacter freundii str. U2785

Toxin (Protein)


Gene name yeeV Uniprot ID S1EZ92
Locus tag CFU2785_RS23335 Protein ID WP_000854726.1
Coordinates 4680792..4681169 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EBQ7
Locus tag CFU2785_RS23340 Protein ID WP_001548930.1
Coordinates 4681259..4681585 (-) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFU2785_RS23315 4676938..4678599 - 1662 WP_046670801.1 fatty acid--CoA ligase -
CFU2785_RS23320 4679171..4680013 - 843 WP_001548928.1 DUF4942 domain-containing protein -
CFU2785_RS23325 4680098..4680295 - 198 WP_000839269.1 DUF957 domain-containing protein -
CFU2785_RS23330 4680307..4680795 - 489 WP_001547769.1 hypothetical protein -
CFU2785_RS23335 4680792..4681169 - 378 WP_000854726.1 TA system toxin CbtA family protein Toxin
CFU2785_RS23340 4681259..4681585 - 327 WP_001548930.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
CFU2785_RS23345 4681604..4681825 - 222 WP_016239820.1 DUF987 domain-containing protein -
CFU2785_RS23350 4681834..4682310 - 477 WP_016243826.1 RadC family protein -
CFU2785_RS23355 4682326..4682784 - 459 WP_000211838.1 antirestriction protein -
CFU2785_RS23360 4682882..4683076 - 195 WP_101743272.1 DUF905 family protein -
CFU2785_RS23365 4682994..4683248 - 255 WP_101743273.1 DUF905 domain-containing protein -
CFU2785_RS23370 4683325..4683792 - 468 WP_001547765.1 hypothetical protein -
CFU2785_RS23375 4683815..4684258 - 444 WP_053263801.1 hypothetical protein -
CFU2785_RS23380 4684258..4684494 - 237 WP_001115854.1 hypothetical protein -
CFU2785_RS23385 4684541..4685242 - 702 WP_008324530.1 WYL domain-containing protein -
CFU2785_RS23390 4685460..4686281 - 822 WP_008324532.1 DUF945 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14164.10 Da        Isoelectric Point: 7.8045

>T292863 WP_000854726.1 NZ_LS992183:c4681169-4680792 [Citrobacter freundii]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12301.97 Da        Isoelectric Point: 7.0273

>AT292863 WP_001548930.1 NZ_LS992183:c4681585-4681259 [Citrobacter freundii]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTFGSCGYVYLAVYPTPETKK

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ92

Antitoxin

Source ID Structure
AlphaFold DB S1EBQ7

References