Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4479926..4480608 | Replicon | chromosome |
| Accession | NZ_LS992183 | ||
| Organism | Citrobacter freundii isolate Citrobacter freundii str. U2785 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | CFU2785_RS22285 | Protein ID | WP_108168483.1 |
| Coordinates | 4480267..4480608 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | CFU2785_RS22280 | Protein ID | WP_108168484.1 |
| Coordinates | 4479926..4480246 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFU2785_RS22240 | 4475486..4476319 | + | 834 | WP_108168491.1 | DUF945 domain-containing protein | - |
| CFU2785_RS22245 | 4476520..4477224 | + | 705 | WP_108168490.1 | WYL domain-containing protein | - |
| CFU2785_RS22250 | 4477221..4477835 | + | 615 | WP_108168489.1 | hypothetical protein | - |
| CFU2785_RS22255 | 4477921..4478331 | + | 411 | WP_043082399.1 | hypothetical protein | - |
| CFU2785_RS22260 | 4478409..4478645 | + | 237 | WP_108168488.1 | DUF905 domain-containing protein | - |
| CFU2785_RS22265 | 4478726..4479184 | + | 459 | WP_108168487.1 | antirestriction protein | - |
| CFU2785_RS22270 | 4479200..4479676 | + | 477 | WP_108168486.1 | RadC family protein | - |
| CFU2785_RS22275 | 4479686..4479907 | + | 222 | WP_108168485.1 | DUF987 domain-containing protein | - |
| CFU2785_RS22280 | 4479926..4480246 | + | 321 | WP_108168484.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CFU2785_RS22285 | 4480267..4480608 | + | 342 | WP_108168483.1 | TA system toxin CbtA family protein | Toxin |
| CFU2785_RS22290 | 4480722..4481555 | + | 834 | WP_099530882.1 | DUF4942 domain-containing protein | - |
| CFU2785_RS22295 | 4482047..4482673 | + | 627 | WP_134216359.1 | SLATT domain-containing protein | - |
| CFU2785_RS22300 | 4482697..4483356 | + | 660 | WP_134216360.1 | RNA-directed DNA polymerase | - |
| CFU2785_RS22305 | 4483403..4483930 | + | 528 | WP_134216361.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4472337..4498708 | 26371 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12956.85 Da Isoelectric Point: 7.2015
>T292861 WP_108168483.1 NZ_LS992183:4480267-4480608 [Citrobacter freundii]
MKPQPATTSRAAELYLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGIMLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
MKPQPATTSRAAELYLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGIMLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|