Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4245200..4245921 | Replicon | chromosome |
Accession | NZ_LS992183 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. U2785 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | CFU2785_RS21095 | Protein ID | WP_063149808.1 |
Coordinates | 4245200..4245541 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | CFU2785_RS21100 | Protein ID | WP_080460847.1 |
Coordinates | 4245577..4245921 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFU2785_RS21065 | 4241216..4241578 | + | 363 | WP_003837149.1 | endoribonuclease SymE | - |
CFU2785_RS21070 | 4241737..4242609 | + | 873 | WP_134216258.1 | HNH endonuclease | - |
CFU2785_RS21075 | 4242738..4243532 | - | 795 | WP_134216261.1 | helix-turn-helix transcriptional regulator | - |
CFU2785_RS21080 | 4243648..4243923 | - | 276 | WP_063149810.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
CFU2785_RS21085 | 4243927..4244175 | - | 249 | WP_000535213.1 | ribbon-helix-helix domain-containing protein | - |
CFU2785_RS21090 | 4244252..4245085 | - | 834 | WP_063149809.1 | DUF4942 domain-containing protein | - |
CFU2785_RS21095 | 4245200..4245541 | - | 342 | WP_063149808.1 | TA system toxin CbtA family protein | Toxin |
CFU2785_RS21100 | 4245577..4245921 | - | 345 | WP_080460847.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
CFU2785_RS21105 | 4245945..4246166 | - | 222 | WP_063149807.1 | DUF987 family protein | - |
CFU2785_RS21110 | 4246114..4246650 | - | 537 | WP_080460846.1 | DNA repair protein RadC | - |
CFU2785_RS21115 | 4246720..4247538 | - | 819 | WP_172616074.1 | DUF945 domain-containing protein | - |
CFU2785_RS21120 | 4247678..4247929 | - | 252 | WP_063149806.1 | DUF905 family protein | - |
CFU2785_RS21125 | 4247926..4248597 | - | 672 | WP_063149805.1 | hypothetical protein | - |
CFU2785_RS26325 | 4248780..4249169 | - | 390 | WP_063149804.1 | hypothetical protein | - |
CFU2785_RS26330 | 4249181..4249888 | - | 708 | Protein_4036 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12865.79 Da Isoelectric Point: 9.8519
>T292859 WP_063149808.1 NZ_LS992183:c4245541-4245200 [Citrobacter freundii]
MKAFPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLTLNDTPFNDESVIQEHINAGITLADAVNFLVEKNELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLLTR
MKAFPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLTLNDTPFNDESVIQEHINAGITLADAVNFLVEKNELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLLTR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|