292848

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 361128..361714 Replicon chromosome
Accession NZ_LS992183
Organism Citrobacter freundii isolate Citrobacter freundii str. U2785

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag CFU2785_RS01785 Protein ID WP_032937237.1
Coordinates 361346..361714 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag CFU2785_RS01780 Protein ID WP_032937236.1
Coordinates 361128..361349 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFU2785_RS01755 356927..357853 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
CFU2785_RS01760 357850..359127 + 1278 WP_003023436.1 branched chain amino acid ABC transporter permease LivM -
CFU2785_RS01765 359124..359891 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
CFU2785_RS01770 359909..360622 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
CFU2785_RS01775 360725..361006 + 282 WP_003023442.1 hypothetical protein -
CFU2785_RS01780 361128..361349 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
CFU2785_RS01785 361346..361714 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
CFU2785_RS01790 361958..363274 + 1317 WP_003837839.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
CFU2785_RS01795 363375..364262 + 888 WP_003837841.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
CFU2785_RS01800 364259..365104 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
CFU2785_RS01805 365107..366177 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T292848 WP_032937237.1 NZ_LS992183:361346-361714 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT292848 WP_032937236.1 NZ_LS992183:361128-361349 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References