Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 85884..86550 | Replicon | chromosome |
Accession | NZ_LS992183 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. U2785 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | CFU2785_RS00460 | Protein ID | WP_134214823.1 |
Coordinates | 86191..86550 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | CFU2785_RS00455 | Protein ID | WP_134214821.1 |
Coordinates | 85884..86201 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFU2785_RS00420 | 81295..81612 | - | 318 | WP_054527950.1 | CcdB family protein | - |
CFU2785_RS00425 | 81612..81905 | - | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
CFU2785_RS00430 | 82002..82367 | - | 366 | WP_134214819.1 | hypothetical protein | - |
CFU2785_RS26200 | 82499..82672 | + | 174 | WP_032938222.1 | hypothetical protein | - |
CFU2785_RS00435 | 82806..83060 | + | 255 | Protein_85 | transposase | - |
CFU2785_RS00440 | 83291..84631 | + | 1341 | WP_008786676.1 | IS110 family transposase | - |
CFU2785_RS00445 | 84645..85562 | + | 918 | Protein_87 | IS3 family transposase | - |
CFU2785_RS00450 | 85583..85744 | + | 162 | WP_003841416.1 | phage protein | - |
CFU2785_RS00455 | 85884..86201 | - | 318 | WP_134214821.1 | helix-turn-helix domain-containing protein | Antitoxin |
CFU2785_RS00460 | 86191..86550 | - | 360 | WP_134214823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFU2785_RS00465 | 86764..87453 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
CFU2785_RS00470 | 87600..89231 | - | 1632 | WP_134214825.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13456.53 Da Isoelectric Point: 10.2555
>T292846 WP_134214823.1 NZ_LS992183:c86550-86191 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|