Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 83653..84178 | Replicon | plasmid 3 |
Accession | NZ_LS992182 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO124 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | ECTO124_RS27185 | Protein ID | WP_001159868.1 |
Coordinates | 83873..84178 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | ECTO124_RS27180 | Protein ID | WP_000813634.1 |
Coordinates | 83653..83871 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO124_RS27155 | 78932..80545 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
ECTO124_RS27160 | 80576..80926 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
ECTO124_RS27165 | 80923..81348 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
ECTO124_RS27170 | 81410..82561 | + | 1152 | WP_031325939.1 | DUF3800 domain-containing protein | - |
ECTO124_RS27175 | 82595..83107 | - | 513 | WP_000151784.1 | hypothetical protein | - |
ECTO124_RS27180 | 83653..83871 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
ECTO124_RS27185 | 83873..84178 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
ECTO124_RS27190 | 84179..84985 | + | 807 | WP_000016982.1 | site-specific integrase | - |
ECTO124_RS27195 | 85759..86514 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
ECTO124_RS27200 | 87102..88268 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) | - | 1..133139 | 133139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T292844 WP_001159868.1 NZ_LS992182:83873-84178 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|