Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 76527..77170 Replicon plasmid 3
Accession NZ_LS992182
Organism Escherichia coli isolate Escherichia coli str. TO124

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag ECTO124_RS27135 Protein ID WP_001034046.1
Coordinates 76527..76943 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag ECTO124_RS27140 Protein ID WP_001261278.1
Coordinates 76940..77170 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO124_RS27120 71664..72080 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
ECTO124_RS27125 72077..72307 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
ECTO124_RS27130 72688..76482 + 3795 WP_001144732.1 hypothetical protein -
ECTO124_RS27135 76527..76943 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
ECTO124_RS27140 76940..77170 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
ECTO124_RS27145 77435..77935 + 501 WP_000528932.1 hypothetical protein -
ECTO124_RS27150 77948..78721 + 774 WP_000905949.1 hypothetical protein -
ECTO124_RS27155 78932..80545 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
ECTO124_RS27160 80576..80926 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
ECTO124_RS27165 80923..81348 - 426 WP_000422741.1 IS66 family insertion sequence hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..133139 133139


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T292843 WP_001034046.1 NZ_LS992182:c76943-76527 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT292843 WP_001261278.1 NZ_LS992182:c77170-76940 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References