Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 71664..72307 | Replicon | plasmid 3 |
Accession | NZ_LS992182 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO124 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | ECTO124_RS27120 | Protein ID | WP_001034044.1 |
Coordinates | 71664..72080 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | ECTO124_RS27125 | Protein ID | WP_001261286.1 |
Coordinates | 72077..72307 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO124_RS27095 | 67470..67777 | + | 308 | Protein_79 | type II toxin-antitoxin system ParD family antitoxin | - |
ECTO124_RS27105 | 68066..68763 | + | 698 | Protein_80 | IS1 family transposase | - |
ECTO124_RS27110 | 69017..70039 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
ECTO124_RS27115 | 70024..71589 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
ECTO124_RS27120 | 71664..72080 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ECTO124_RS27125 | 72077..72307 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ECTO124_RS27130 | 72688..76482 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
ECTO124_RS27135 | 76527..76943 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
ECTO124_RS27140 | 76940..77170 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) | - | 1..133139 | 133139 | |
- | flank | IS/Tn | - | - | 68260..68763 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T292842 WP_001034044.1 NZ_LS992182:c72080-71664 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |