Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4408877..4409712 | Replicon | chromosome |
| Accession | NZ_LS992180 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | ECTO124_RS22075 | Protein ID | WP_000854759.1 |
| Coordinates | 4408877..4409254 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | ECTO124_RS22080 | Protein ID | WP_001295723.1 |
| Coordinates | 4409344..4409712 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS22050 | 4404988..4406628 | - | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| ECTO124_RS22055 | 4407401..4407577 | - | 177 | Protein_4231 | helix-turn-helix domain-containing protein | - |
| ECTO124_RS27750 | 4407941..4408099 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| ECTO124_RS22065 | 4408199..4408375 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| ECTO124_RS22070 | 4408392..4408880 | - | 489 | WP_000761690.1 | hypothetical protein | - |
| ECTO124_RS22075 | 4408877..4409254 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| ECTO124_RS22080 | 4409344..4409712 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO124_RS22085 | 4409985..4410731 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| ECTO124_RS22090 | 4410746..4412287 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| ECTO124_RS22095 | 4412428..4412682 | - | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
| ECTO124_RS22100 | 4412745..4413221 | - | 477 | WP_001186775.1 | RadC family protein | - |
| ECTO124_RS22105 | 4413237..4413710 | - | 474 | WP_001350782.1 | antirestriction protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T292827 WP_000854759.1 NZ_LS992180:c4409254-4408877 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT292827 WP_001295723.1 NZ_LS992180:c4409712-4409344 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |