Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3764484..3765102 | Replicon | chromosome |
| Accession | NZ_LS992180 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | ECTO124_RS18980 | Protein ID | WP_001291435.1 |
| Coordinates | 3764884..3765102 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | ECTO124_RS18975 | Protein ID | WP_000344800.1 |
| Coordinates | 3764484..3764858 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS18965 | 3759573..3760766 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ECTO124_RS18970 | 3760789..3763938 | + | 3150 | WP_001132478.1 | multidrug efflux RND transporter permease subunit | - |
| ECTO124_RS18975 | 3764484..3764858 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| ECTO124_RS18980 | 3764884..3765102 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| ECTO124_RS18985 | 3765276..3765827 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| ECTO124_RS18990 | 3765943..3766413 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| ECTO124_RS18995 | 3766577..3768127 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| ECTO124_RS19000 | 3768169..3768522 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| ECTO124_RS19010 | 3768901..3769212 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| ECTO124_RS19015 | 3769243..3769815 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T292822 WP_001291435.1 NZ_LS992180:3764884-3765102 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT292822 WP_000344800.1 NZ_LS992180:3764484-3764858 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |