292815

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1966058..1966889 Replicon chromosome
Accession NZ_LS992180
Organism Escherichia coli isolate Escherichia coli str. TO124

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag ECTO124_RS09430 Protein ID WP_000854815.1
Coordinates 1966058..1966432 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag ECTO124_RS09435 Protein ID WP_001280918.1
Coordinates 1966521..1966889 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO124_RS09390 1961454..1962620 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
ECTO124_RS09395 1962739..1963212 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
ECTO124_RS09400 1963410..1964468 + 1059 WP_001200889.1 FUSC family protein -
ECTO124_RS09405 1964640..1964969 + 330 WP_000450409.1 DUF496 family protein -
ECTO124_RS09410 1965070..1965252 - 183 WP_001296208.1 hypothetical protein -
ECTO124_RS09415 1965306..1965452 + 147 Protein_1799 transposase domain-containing protein -
ECTO124_RS09420 1965741..1965854 - 114 WP_001161660.1 DUF957 domain-containing protein -
ECTO124_RS09425 1965867..1966061 - 195 WP_000988600.1 hypothetical protein -
ECTO124_RS09430 1966058..1966432 - 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
ECTO124_RS09435 1966521..1966889 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO124_RS09440 1966905..1967549 - 645 WP_000086752.1 hypothetical protein -
ECTO124_RS09445 1967568..1967789 - 222 WP_000692345.1 DUF987 domain-containing protein -
ECTO124_RS09450 1967852..1968328 - 477 WP_001186200.1 RadC family protein -
ECTO124_RS09455 1968344..1968817 - 474 WP_001542276.1 antirestriction protein -
ECTO124_RS09460 1968911..1969156 - 246 WP_001164966.1 hypothetical protein -
ECTO124_RS09465 1969156..1969974 - 819 WP_001542275.1 DUF945 domain-containing protein -
ECTO124_RS09475 1970195..1970605 - 411 WP_000846703.1 hypothetical protein -
ECTO124_RS09480 1970621..1970971 - 351 Protein_1811 hypothetical protein -
ECTO124_RS09490 1971054..1971800 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T292815 WP_000854815.1 NZ_LS992180:c1966432-1966058 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT292815 WP_001280918.1 NZ_LS992180:c1966889-1966521 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References