Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1966058..1966889 | Replicon | chromosome |
| Accession | NZ_LS992180 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | ECTO124_RS09430 | Protein ID | WP_000854815.1 |
| Coordinates | 1966058..1966432 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | ECTO124_RS09435 | Protein ID | WP_001280918.1 |
| Coordinates | 1966521..1966889 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS09390 | 1961454..1962620 | + | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| ECTO124_RS09395 | 1962739..1963212 | + | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| ECTO124_RS09400 | 1963410..1964468 | + | 1059 | WP_001200889.1 | FUSC family protein | - |
| ECTO124_RS09405 | 1964640..1964969 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| ECTO124_RS09410 | 1965070..1965252 | - | 183 | WP_001296208.1 | hypothetical protein | - |
| ECTO124_RS09415 | 1965306..1965452 | + | 147 | Protein_1799 | transposase domain-containing protein | - |
| ECTO124_RS09420 | 1965741..1965854 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| ECTO124_RS09425 | 1965867..1966061 | - | 195 | WP_000988600.1 | hypothetical protein | - |
| ECTO124_RS09430 | 1966058..1966432 | - | 375 | WP_000854815.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| ECTO124_RS09435 | 1966521..1966889 | - | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO124_RS09440 | 1966905..1967549 | - | 645 | WP_000086752.1 | hypothetical protein | - |
| ECTO124_RS09445 | 1967568..1967789 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| ECTO124_RS09450 | 1967852..1968328 | - | 477 | WP_001186200.1 | RadC family protein | - |
| ECTO124_RS09455 | 1968344..1968817 | - | 474 | WP_001542276.1 | antirestriction protein | - |
| ECTO124_RS09460 | 1968911..1969156 | - | 246 | WP_001164966.1 | hypothetical protein | - |
| ECTO124_RS09465 | 1969156..1969974 | - | 819 | WP_001542275.1 | DUF945 domain-containing protein | - |
| ECTO124_RS09475 | 1970195..1970605 | - | 411 | WP_000846703.1 | hypothetical protein | - |
| ECTO124_RS09480 | 1970621..1970971 | - | 351 | Protein_1811 | hypothetical protein | - |
| ECTO124_RS09490 | 1971054..1971800 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T292815 WP_000854815.1 NZ_LS992180:c1966432-1966058 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.70 Da Isoelectric Point: 6.4767
>AT292815 WP_001280918.1 NZ_LS992180:c1966889-1966521 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |