Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1032101..1032755 | Replicon | chromosome |
| Accession | NZ_LS992180 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO124 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | ECTO124_RS05175 | Protein ID | WP_000244765.1 |
| Coordinates | 1032348..1032755 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | ECTO124_RS05170 | Protein ID | WP_000354050.1 |
| Coordinates | 1032101..1032367 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO124_RS05150 | 1028189..1029622 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
| ECTO124_RS05155 | 1029667..1029978 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| ECTO124_RS05160 | 1030142..1030801 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
| ECTO124_RS05165 | 1030878..1031858 | - | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
| ECTO124_RS05170 | 1032101..1032367 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| ECTO124_RS05175 | 1032348..1032755 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| ECTO124_RS05180 | 1032795..1033316 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| ECTO124_RS05185 | 1033428..1034324 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| ECTO124_RS05190 | 1034349..1035059 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ECTO124_RS05195 | 1035065..1036798 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T292813 WP_000244765.1 NZ_LS992180:1032348-1032755 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |