Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 885585..886419 Replicon chromosome
Accession NZ_LS992180
Organism Escherichia coli isolate Escherichia coli str. TO124

Toxin (Protein)


Gene name yeeV Uniprot ID A0A8E0IX31
Locus tag ECTO124_RS04325 Protein ID WP_000854689.1
Coordinates 885585..885962 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1X3JHN3
Locus tag ECTO124_RS04330 Protein ID WP_001285598.1
Coordinates 886039..886419 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO124_RS04295 881965..882135 - 171 Protein_828 IS110 family transposase -
ECTO124_RS04300 882606..883499 - 894 WP_001114681.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ECTO124_RS04305 883492..883887 - 396 WP_000208383.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
ECTO124_RS04310 883956..884801 - 846 WP_023281696.1 DUF4942 domain-containing protein -
ECTO124_RS04315 884886..885083 - 198 WP_000839293.1 DUF957 domain-containing protein -
ECTO124_RS04320 885100..885588 - 489 WP_000761699.1 hypothetical protein -
ECTO124_RS04325 885585..885962 - 378 WP_000854689.1 TA system toxin CbtA family protein Toxin
ECTO124_RS04330 886039..886419 - 381 WP_001285598.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO124_RS04335 886469..887113 - 645 WP_000094916.1 hypothetical protein -
ECTO124_RS04340 887132..887353 - 222 WP_000692329.1 DUF987 domain-containing protein -
ECTO124_RS04345 887416..887892 - 477 WP_001186726.1 RadC family protein -
ECTO124_RS04350 887908..888393 - 486 WP_000849566.1 antirestriction protein -
ECTO124_RS04355 888448..889266 - 819 WP_001234620.1 DUF945 domain-containing protein -
ECTO124_RS04365 889367..889576 - 210 WP_032142237.1 DUF905 family protein -
ECTO124_RS04370 889681..890136 - 456 WP_000581502.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14042.07 Da        Isoelectric Point: 9.1510

>T292812 WP_000854689.1 NZ_LS992180:c885962-885585 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13927.72 Da        Isoelectric Point: 4.7959

>AT292812 WP_001285598.1 NZ_LS992180:c886419-886039 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1X3JHN3

References