Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 45960..46795 | Replicon | chromosome |
Accession | NZ_LS992180 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO124 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A376WVB1 |
Locus tag | ECTO124_RS00240 | Protein ID | WP_001094448.1 |
Coordinates | 45960..46337 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
Locus tag | ECTO124_RS00245 | Protein ID | WP_024175935.1 |
Coordinates | 46427..46795 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO124_RS00210 | 41328..42146 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
ECTO124_RS00215 | 42150..43073 | - | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
ECTO124_RS00220 | 43251..43748 | - | 498 | WP_000509815.1 | hypothetical protein | - |
ECTO124_RS00225 | 44341..45186 | - | 846 | WP_000065751.1 | DUF4942 domain-containing protein | - |
ECTO124_RS00230 | 45242..45463 | - | 222 | WP_001296561.1 | DUF957 domain-containing protein | - |
ECTO124_RS00235 | 45475..45963 | - | 489 | WP_000761714.1 | hypothetical protein | - |
ECTO124_RS00240 | 45960..46337 | - | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
ECTO124_RS00245 | 46427..46795 | - | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ECTO124_RS00250 | 46869..47090 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
ECTO124_RS00255 | 47159..47635 | - | 477 | WP_001186709.1 | RadC family protein | - |
ECTO124_RS00260 | 47647..48132 | - | 486 | WP_000214415.1 | antirestriction protein | - |
ECTO124_RS00265 | 48224..49042 | - | 819 | WP_001234753.1 | DUF945 domain-containing protein | - |
ECTO124_RS00270 | 49133..49366 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T292807 WP_001094448.1 NZ_LS992180:c46337-45960 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A376WVB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T7EC32 |