Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 32057..32860 | Replicon | plasmid 2 |
Accession | NZ_LS992176 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. E2614 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A7W3E3C9 |
Locus tag | CFE2614_RS25860 | Protein ID | WP_022652313.1 |
Coordinates | 32330..32860 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W8E6Q5 |
Locus tag | CFE2614_RS25855 | Protein ID | WP_022652312.1 |
Coordinates | 32057..32326 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFE2614_RS25835 | 28362..28669 | - | 308 | Protein_27 | IS1 family transposase | - |
CFE2614_RS25845 | 29146..29886 | + | 741 | WP_022652310.1 | site-specific integrase | - |
CFE2614_RS25850 | 30212..31201 | - | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
CFE2614_RS25855 | 32057..32326 | + | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
CFE2614_RS25860 | 32330..32860 | + | 531 | WP_022652313.1 | GNAT family N-acetyltransferase | Toxin |
CFE2614_RS25865 | 32992..33885 | + | 894 | WP_077873527.1 | IS5 family transposase | - |
CFE2614_RS25870 | 34026..34922 | - | 897 | Protein_33 | IS3 family transposase | - |
CFE2614_RS25875 | 34987..36138 | + | 1152 | WP_022652315.1 | IS30-like element IS30 family transposase | - |
CFE2614_RS25880 | 36247..36630 | + | 384 | WP_001201739.1 | IS66 family insertion sequence hypothetical protein | - |
CFE2614_RS25885 | 36627..36974 | + | 348 | WP_000609174.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaVIM-1 / ant(3'')-Ia / qacE / sul1 / mph(A) / aac(3)-IId / blaTEM-1B | - | 1..159493 | 159493 | |
- | inside | IScluster/Tn | - | - | 27048..40429 | 13381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20349.26 Da Isoelectric Point: 6.7496
>T292806 WP_022652313.1 NZ_LS992176:32330-32860 [Citrobacter freundii]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3E3C9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z3XDS5 |