Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4830031..4830697 | Replicon | chromosome |
Accession | NZ_LS992175 | ||
Organism | Citrobacter freundii isolate Citrobacter freundii str. E2614 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0D7LIM5 |
Locus tag | CFE2614_RS24065 | Protein ID | WP_044702260.1 |
Coordinates | 4830338..4830697 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0D7LIR0 |
Locus tag | CFE2614_RS24060 | Protein ID | WP_003844682.1 |
Coordinates | 4830031..4830348 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFE2614_RS24030 | 4825698..4826522 | + | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
CFE2614_RS24035 | 4826591..4827814 | + | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
CFE2614_RS24040 | 4827816..4828628 | + | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
CFE2614_RS24045 | 4828680..4829036 | - | 357 | WP_032948294.1 | hypothetical protein | - |
CFE2614_RS24050 | 4829178..4829339 | + | 162 | WP_003841416.1 | phage protein | - |
CFE2614_RS24055 | 4829743..4830021 | + | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
CFE2614_RS24060 | 4830031..4830348 | - | 318 | WP_003844682.1 | helix-turn-helix domain-containing protein | Antitoxin |
CFE2614_RS24065 | 4830338..4830697 | - | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFE2614_RS24070 | 4830911..4831600 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
CFE2614_RS24075 | 4831666..4833297 | - | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T292804 WP_044702260.1 NZ_LS992175:c4830697-4830338 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIM5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIR0 |