Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4582033..4582549 | Replicon | chromosome |
| Accession | NZ_LS992175 | ||
| Organism | Citrobacter freundii isolate Citrobacter freundii str. E2614 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | CFE2614_RS22855 | Protein ID | WP_044699148.1 |
| Coordinates | 4582033..4582317 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | CFE2614_RS22860 | Protein ID | WP_003839576.1 |
| Coordinates | 4582307..4582549 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFE2614_RS22840 | 4578358..4578942 | + | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
| CFE2614_RS22845 | 4579320..4581458 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| CFE2614_RS22850 | 4581565..4582029 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| CFE2614_RS22855 | 4582033..4582317 | - | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CFE2614_RS22860 | 4582307..4582549 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| CFE2614_RS22865 | 4582627..4584540 | - | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
| CFE2614_RS22870 | 4584562..4585302 | - | 741 | WP_044699149.1 | KDGP aldolase family protein | - |
| CFE2614_RS22875 | 4585299..4586417 | - | 1119 | WP_044699152.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| CFE2614_RS22880 | 4586401..4587534 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T292803 WP_044699148.1 NZ_LS992175:c4582317-4582033 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|