Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 4100858..4101537 | Replicon | chromosome |
| Accession | NZ_LS992175 | ||
| Organism | Citrobacter freundii isolate Citrobacter freundii str. E2614 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
| Locus tag | CFE2614_RS20520 | Protein ID | WP_003031349.1 |
| Coordinates | 4101196..4101537 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
| Locus tag | CFE2614_RS20515 | Protein ID | WP_003031347.1 |
| Coordinates | 4100858..4101175 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFE2614_RS20490 | 4096951..4098948 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
| CFE2614_RS20495 | 4099452..4099643 | + | 192 | Protein_3919 | DUF905 family protein | - |
| CFE2614_RS20500 | 4099657..4100118 | + | 462 | WP_003031344.1 | antirestriction protein | - |
| CFE2614_RS20505 | 4100134..4100610 | + | 477 | WP_003031345.1 | RadC family protein | - |
| CFE2614_RS20510 | 4100619..4100840 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
| CFE2614_RS20515 | 4100858..4101175 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CFE2614_RS20520 | 4101196..4101537 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| CFE2614_RS20525 | 4102127..4102618 | - | 492 | WP_121927018.1 | tail fiber assembly protein | - |
| CFE2614_RS20530 | 4103739..4104182 | - | 444 | Protein_3926 | phage tail protein | - |
| CFE2614_RS20535 | 4104182..4104862 | - | 681 | WP_121927014.1 | DUF2612 domain-containing protein | - |
| CFE2614_RS20540 | 4104859..4106058 | - | 1200 | WP_121927013.1 | baseplate J/gp47 family protein | - |
| CFE2614_RS20545 | 4106059..4106412 | - | 354 | WP_016239889.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4085894..4144353 | 58459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T292802 WP_003031349.1 NZ_LS992175:4101196-4101537 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLJ2 |