Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3865204..3865824 Replicon chromosome
Accession NZ_LS992175
Organism Citrobacter freundii isolate Citrobacter freundii str. E2614

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag CFE2614_RS19370 Protein ID WP_002892050.1
Coordinates 3865606..3865824 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID R8WZW8
Locus tag CFE2614_RS19365 Protein ID WP_003021733.1
Coordinates 3865204..3865578 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFE2614_RS19355 3860351..3861544 + 1194 WP_003835922.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
CFE2614_RS19360 3861567..3864716 + 3150 WP_003021736.1 multidrug efflux RND transporter permease subunit -
CFE2614_RS19365 3865204..3865578 + 375 WP_003021733.1 Hha toxicity modulator TomB Antitoxin
CFE2614_RS19370 3865606..3865824 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
CFE2614_RS19375 3866131..3866682 + 552 WP_044699372.1 maltose O-acetyltransferase -
CFE2614_RS19380 3866799..3867269 + 471 WP_003021724.1 YlaC family protein -
CFE2614_RS19385 3867348..3867488 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
CFE2614_RS19390 3867490..3867750 - 261 WP_003021719.1 type B 50S ribosomal protein L31 -
CFE2614_RS19395 3867939..3869492 + 1554 WP_044699371.1 EAL domain-containing protein -
CFE2614_RS19400 3869544..3869897 - 354 WP_003831033.1 DUF1428 family protein -
CFE2614_RS19405 3869962..3870591 - 630 WP_003835929.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T292801 WP_002892050.1 NZ_LS992175:3865606-3865824 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14427.23 Da        Isoelectric Point: 5.5653

>AT292801 WP_003021733.1 NZ_LS992175:3865204-3865578 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB R8WZW8

References