Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4056183..4057003 | Replicon | chromosome |
Accession | NZ_LS992171 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO73 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | ECTO73_RS19830 | Protein ID | WP_001054379.1 |
Coordinates | 4056183..4056440 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | ECTO73_RS19835 | Protein ID | WP_000123957.1 |
Coordinates | 4056452..4057003 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO73_RS19810 | 4051470..4052576 | + | 1107 | WP_001295733.1 | N-acetylneuraminate epimerase | - |
ECTO73_RS19815 | 4052640..4053620 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
ECTO73_RS19820 | 4054203..4055429 | - | 1227 | Protein_3848 | helicase YjhR | - |
ECTO73_RS19825 | 4055507..4055806 | + | 300 | WP_001332034.1 | GNAT family N-acetyltransferase | - |
ECTO73_RS19830 | 4056183..4056440 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
ECTO73_RS19835 | 4056452..4057003 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
ECTO73_RS19840 | 4057055..4057801 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
ECTO73_RS19845 | 4057929..4058189 | + | 261 | WP_000077645.1 | hypothetical protein | - |
ECTO73_RS24295 | 4058227..4058343 | + | 117 | Protein_3854 | VOC family protein | - |
ECTO73_RS19850 | 4058588..4059709 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
ECTO73_RS19855 | 4059706..4059984 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
ECTO73_RS19860 | 4059996..4061309 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T292779 WP_001054379.1 NZ_LS992171:4056183-4056440 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT292779 WP_000123957.1 NZ_LS992171:4056452-4057003 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|