292760

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 32163..32628 Replicon plasmid 3
Accession NZ_LS992170
Organism Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag ECTO60_RS26410 Protein ID WP_001230707.1
Coordinates 32163..32414 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag ECTO60_RS26415 Protein ID WP_000801440.1
Coordinates 32401..32628 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO60_RS26385 27561..28427 - 867 WP_001353743.1 replication initiation protein -
ECTO60_RS26390 29682..30017 + 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -
ECTO60_RS26395 30014..30364 + 351 WP_000127482.1 addiction module antitoxin -
ECTO60_RS26400 31004..31519 + 516 WP_001025395.1 J domain-containing protein -
ECTO60_RS26405 31624..32166 + 543 WP_001083906.1 hypothetical protein -
ECTO60_RS26410 32163..32414 + 252 WP_001230707.1 hypothetical protein Toxin
ECTO60_RS26415 32401..32628 + 228 WP_000801440.1 hypothetical protein Antitoxin
ECTO60_RS26425 33082..33381 + 300 WP_000650311.1 hypothetical protein -
ECTO60_RS26430 33391..33807 + 417 WP_012421208.1 tail-associated lysozyme -
ECTO60_RS26435 33804..34115 + 312 WP_000627400.1 hypothetical protein -
ECTO60_RS26440 34420..34551 + 132 WP_001353745.1 toxin-antitoxin system HicB family antitoxin -
ECTO60_RS26450 34912..35415 + 504 WP_000781814.1 hypothetical protein -
ECTO60_RS26455 35419..36648 + 1230 WP_000539543.1 relaxase/mobilization nuclease domain-containing protein -
ECTO60_RS26460 36725..37018 + 294 WP_000134733.1 LuxR family transcriptional regulator -
ECTO60_RS26465 37015..37230 + 216 WP_000760375.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..46051 46051


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T292760 WP_001230707.1 NZ_LS992170:32163-32414 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT292760 WP_000801440.1 NZ_LS992170:32401-32628 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References