Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 119947..120548 | Replicon | plasmid 2 |
| Accession | NZ_LS992169 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO60 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | ECTO60_RS25785 | Protein ID | WP_001216034.1 |
| Coordinates | 120168..120548 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | ECTO60_RS25780 | Protein ID | WP_001190712.1 |
| Coordinates | 119947..120168 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO60_RS25770 | 116928..118211 | - | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
| ECTO60_RS25775 | 118208..119764 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| ECTO60_RS25780 | 119947..120168 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ECTO60_RS25785 | 120168..120548 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| ECTO60_RS25790 | 120553..120732 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| ECTO60_RS25795 | 120760..121119 | + | 360 | WP_001513660.1 | hypothetical protein | - |
| ECTO60_RS25800 | 121043..121456 | + | 414 | Protein_141 | DDE-type integrase/transposase/recombinase | - |
| ECTO60_RS25805 | 121406..121723 | - | 318 | WP_001513659.1 | hypothetical protein | - |
| ECTO60_RS25810 | 121951..122931 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| ECTO60_RS25815 | 123175..124578 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| ECTO60_RS25820 | 124565..125497 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB / senB | 1..172923 | 172923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T292759 WP_001216034.1 NZ_LS992169:120168-120548 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |