292759

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 119947..120548 Replicon plasmid 2
Accession NZ_LS992169
Organism Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag ECTO60_RS25785 Protein ID WP_001216034.1
Coordinates 120168..120548 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag ECTO60_RS25780 Protein ID WP_001190712.1
Coordinates 119947..120168 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO60_RS25770 116928..118211 - 1284 WP_001617890.1 restriction endonuclease subunit S -
ECTO60_RS25775 118208..119764 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
ECTO60_RS25780 119947..120168 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ECTO60_RS25785 120168..120548 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ECTO60_RS25790 120553..120732 + 180 WP_001513661.1 hypothetical protein -
ECTO60_RS25795 120760..121119 + 360 WP_001513660.1 hypothetical protein -
ECTO60_RS25800 121043..121456 + 414 Protein_141 DDE-type integrase/transposase/recombinase -
ECTO60_RS25805 121406..121723 - 318 WP_001513659.1 hypothetical protein -
ECTO60_RS25810 121951..122931 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
ECTO60_RS25815 123175..124578 + 1404 WP_001373486.1 S-methylmethionine permease -
ECTO60_RS25820 124565..125497 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB / senB 1..172923 172923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T292759 WP_001216034.1 NZ_LS992169:120168-120548 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT292759 WP_001190712.1 NZ_LS992169:119947-120168 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References