Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 109478..110003 | Replicon | plasmid 2 |
| Accession | NZ_LS992169 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO60 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | ECTO60_RS25740 | Protein ID | WP_001159868.1 |
| Coordinates | 109478..109783 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | ECTO60_RS25745 | Protein ID | WP_000813634.1 |
| Coordinates | 109785..110003 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO60_RS25725 | 105388..106554 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| ECTO60_RS25730 | 107142..107897 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| ECTO60_RS25735 | 108671..109477 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| ECTO60_RS25740 | 109478..109783 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| ECTO60_RS25745 | 109785..110003 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| ECTO60_RS25750 | 110711..111706 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| ECTO60_RS25755 | 111710..112642 | + | 933 | WP_000991832.1 | hypothetical protein | - |
| ECTO60_RS25760 | 112779..113476 | - | 698 | Protein_133 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB / senB | 1..172923 | 172923 | |
| - | flank | IS/Tn | - | - | 112779..113282 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T292758 WP_001159868.1 NZ_LS992169:c109783-109478 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|