Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4302512..4303347 | Replicon | chromosome |
| Accession | NZ_LS992168 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO60 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | ECTO60_RS21455 | Protein ID | WP_000854759.1 |
| Coordinates | 4302512..4302889 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | ECTO60_RS21460 | Protein ID | WP_001295723.1 |
| Coordinates | 4302979..4303347 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO60_RS21430 | 4298623..4300263 | - | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| ECTO60_RS21435 | 4301036..4301212 | - | 177 | Protein_4125 | helix-turn-helix domain-containing protein | - |
| ECTO60_RS26730 | 4301576..4301734 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| ECTO60_RS21445 | 4301834..4302010 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| ECTO60_RS21450 | 4302027..4302515 | - | 489 | WP_000761690.1 | hypothetical protein | - |
| ECTO60_RS21455 | 4302512..4302889 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| ECTO60_RS21460 | 4302979..4303347 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO60_RS21465 | 4303510..4303731 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| ECTO60_RS21470 | 4303794..4304270 | - | 477 | WP_001186775.1 | RadC family protein | - |
| ECTO60_RS21475 | 4304286..4304759 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| ECTO60_RS21485 | 4305101..4305919 | - | 819 | WP_001234738.1 | DUF945 domain-containing protein | - |
| ECTO60_RS21495 | 4306074..4306232 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4290866..4320127 | 29261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T292746 WP_000854759.1 NZ_LS992168:c4302889-4302512 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT292746 WP_001295723.1 NZ_LS992168:c4303347-4302979 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |