Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4269890..4270710 | Replicon | chromosome |
Accession | NZ_LS992168 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO60 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | ECTO60_RS21295 | Protein ID | WP_001054379.1 |
Coordinates | 4269890..4270147 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | ECTO60_RS21300 | Protein ID | WP_000123957.1 |
Coordinates | 4270159..4270710 (+) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO60_RS21275 | 4265437..4266417 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
ECTO60_RS21280 | 4267000..4268106 | - | 1107 | Protein_4094 | helicase YjhR | - |
ECTO60_RS21285 | 4268169..4269316 | + | 1148 | WP_085949154.1 | IS3-like element ISEc52 family transposase | - |
ECTO60_RS21290 | 4269349..4269513 | + | 165 | Protein_4096 | GNAT family N-acetyltransferase | - |
ECTO60_RS21295 | 4269890..4270147 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
ECTO60_RS21300 | 4270159..4270710 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
ECTO60_RS21305 | 4270762..4271508 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
ECTO60_RS21310 | 4271636..4271896 | + | 261 | WP_000077645.1 | hypothetical protein | - |
ECTO60_RS26725 | 4271934..4272050 | + | 117 | Protein_4101 | VOC family protein | - |
ECTO60_RS21315 | 4272295..4273416 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
ECTO60_RS21320 | 4273413..4273691 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
ECTO60_RS21325 | 4273703..4275016 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimE | 4258511..4278931 | 20420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T292745 WP_001054379.1 NZ_LS992168:4269890-4270147 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT292745 WP_000123957.1 NZ_LS992168:4270159-4270710 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|