Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1896495..1897326 Replicon chromosome
Accession NZ_LS992168
Organism Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag ECTO60_RS09075 Protein ID WP_000854815.1
Coordinates 1896495..1896869 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag ECTO60_RS09080 Protein ID WP_001280918.1
Coordinates 1896958..1897326 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO60_RS09035 1891891..1893057 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
ECTO60_RS09040 1893176..1893649 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
ECTO60_RS09045 1893847..1894905 + 1059 WP_001200889.1 FUSC family protein -
ECTO60_RS09050 1895077..1895406 + 330 WP_000450409.1 DUF496 family protein -
ECTO60_RS09055 1895507..1895689 - 183 WP_001296208.1 hypothetical protein -
ECTO60_RS09060 1895743..1895889 + 147 Protein_1742 transposase domain-containing protein -
ECTO60_RS09065 1896178..1896291 - 114 WP_001161660.1 DUF957 domain-containing protein -
ECTO60_RS09070 1896304..1896498 - 195 WP_000988600.1 hypothetical protein -
ECTO60_RS09075 1896495..1896869 - 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
ECTO60_RS09080 1896958..1897326 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO60_RS09085 1897342..1897986 - 645 WP_000086752.1 hypothetical protein -
ECTO60_RS09090 1898005..1898226 - 222 WP_000692345.1 DUF987 domain-containing protein -
ECTO60_RS09095 1898289..1898765 - 477 WP_001186200.1 RadC family protein -
ECTO60_RS09100 1898781..1899254 - 474 WP_001542276.1 antirestriction protein -
ECTO60_RS09105 1899348..1899593 - 246 WP_001164966.1 hypothetical protein -
ECTO60_RS09110 1899593..1900411 - 819 WP_001542275.1 DUF945 domain-containing protein -
ECTO60_RS09120 1900632..1901042 - 411 WP_000846703.1 hypothetical protein -
ECTO60_RS09125 1901058..1901408 - 351 Protein_1754 hypothetical protein -
ECTO60_RS09135 1901491..1902237 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T292734 WP_000854815.1 NZ_LS992168:c1896869-1896495 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT292734 WP_001280918.1 NZ_LS992168:c1897326-1896958 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References