Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 820677..821511 Replicon chromosome
Accession NZ_LS992168
Organism Escherichia coli isolate Escherichia coli str. TO60

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag ECTO60_RS03995 Protein ID WP_000854690.1
Coordinates 820677..821054 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag ECTO60_RS04000 Protein ID WP_001305076.1
Coordinates 821143..821511 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO60_RS26525 817071..817226 - 156 WP_000729638.1 hypothetical protein -
ECTO60_RS03970 817658..818591 - 934 Protein_776 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ECTO60_RS03975 818584..818979 - 396 WP_000208384.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
ECTO60_RS03980 819048..819893 - 846 WP_001529401.1 DUF4942 domain-containing protein -
ECTO60_RS03985 819978..820175 - 198 WP_000839293.1 DUF957 domain-containing protein -
ECTO60_RS03990 820192..820680 - 489 WP_000761699.1 hypothetical protein -
ECTO60_RS03995 820677..821054 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
ECTO60_RS04000 821143..821511 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO60_RS04005 821561..822205 - 645 WP_000094916.1 hypothetical protein -
ECTO60_RS04010 822224..822445 - 222 WP_000692329.1 DUF987 domain-containing protein -
ECTO60_RS04015 822508..822984 - 477 WP_001186726.1 RadC family protein -
ECTO60_RS04020 823000..823485 - 486 WP_000849565.1 antirestriction protein -
ECTO60_RS04025 823540..824358 - 819 WP_001234620.1 DUF945 domain-containing protein -
ECTO60_RS04035 824459..824692 - 234 WP_000902034.1 DUF905 family protein -
ECTO60_RS04040 824771..825226 - 456 WP_000581502.1 hypothetical protein -
ECTO60_RS04045 825302..826429 - 1128 Protein_790 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 799407..867183 67776
- flank IS/Tn - - 817071..817226 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T292731 WP_000854690.1 NZ_LS992168:c821054-820677 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT292731 WP_001305076.1 NZ_LS992168:c821511-821143 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References