Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4200114..4200946 | Replicon | chromosome |
| Accession | NZ_LS992166 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | ECTO6_RS20615 | Protein ID | WP_000854765.1 |
| Coordinates | 4200114..4200488 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | ECTO6_RS20620 | Protein ID | WP_001529626.1 |
| Coordinates | 4200578..4200946 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS20560 | 4195156..4196136 | + | 981 | WP_001529628.1 | transposase | - |
| ECTO6_RS20565 | 4196144..4196794 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| ECTO6_RS20595 | 4198032..4199260 | + | 1229 | Protein_3998 | IS3-like element IS2 family transposase | - |
| ECTO6_RS20605 | 4199433..4199609 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
| ECTO6_RS20610 | 4199626..4200117 | - | 492 | WP_000976842.1 | hypothetical protein | - |
| ECTO6_RS20615 | 4200114..4200488 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| ECTO6_RS20620 | 4200578..4200946 | - | 369 | WP_001529626.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO6_RS20625 | 4201109..4201330 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| ECTO6_RS20630 | 4201399..4201875 | - | 477 | WP_001354275.1 | RadC family protein | - |
| ECTO6_RS20635 | 4201891..4202364 | - | 474 | WP_001387789.1 | antirestriction protein | - |
| ECTO6_RS20645 | 4202706..4203524 | - | 819 | WP_134091970.1 | DUF945 domain-containing protein | - |
| ECTO6_RS20655 | 4203679..4203837 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE | 4190121..4202364 | 12243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T292719 WP_000854765.1 NZ_LS992166:c4200488-4200114 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13664.46 Da Isoelectric Point: 6.3171
>AT292719 WP_001529626.1 NZ_LS992166:c4200946-4200578 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWELPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWELPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|