Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1076765..1077348 | Replicon | chromosome |
| Accession | NZ_LS992166 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | ECTO6_RS05250 | Protein ID | WP_000254738.1 |
| Coordinates | 1077013..1077348 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | ECTO6_RS05245 | Protein ID | WP_000581937.1 |
| Coordinates | 1076765..1077013 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS05235 | 1073104..1074405 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| ECTO6_RS05240 | 1074453..1076687 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| ECTO6_RS05245 | 1076765..1077013 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ECTO6_RS05250 | 1077013..1077348 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| ECTO6_RS05255 | 1077419..1078210 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| ECTO6_RS05260 | 1078438..1080075 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| ECTO6_RS05265 | 1080163..1081461 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| ECTO6_RS05270 | 1081521..1082183 | - | 663 | Protein_1021 | TPM domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T292707 WP_000254738.1 NZ_LS992166:1077013-1077348 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|