Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 829329..830161 | Replicon | chromosome |
| Accession | NZ_LS992166 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO6 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3P5UBZ5 |
| Locus tag | ECTO6_RS04035 | Protein ID | WP_001094454.1 |
| Coordinates | 829329..829703 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3G8RJV8 |
| Locus tag | ECTO6_RS04040 | Protein ID | WP_001320394.1 |
| Coordinates | 829793..830161 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO6_RS04005 | 824443..825591 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| ECTO6_RS04010 | 825663..826646 | - | 984 | WP_001598619.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| ECTO6_RS04015 | 827457..827627 | - | 171 | Protein_785 | IS110 family transposase | - |
| ECTO6_RS04020 | 827969..828538 | - | 570 | WP_001290250.1 | DUF4942 domain-containing protein | - |
| ECTO6_RS04025 | 828635..828832 | - | 198 | WP_000839276.1 | DUF957 domain-containing protein | - |
| ECTO6_RS04030 | 828844..829332 | - | 489 | WP_000777545.1 | hypothetical protein | - |
| ECTO6_RS04035 | 829329..829703 | - | 375 | WP_001094454.1 | TA system toxin CbtA family protein | Toxin |
| ECTO6_RS04040 | 829793..830161 | - | 369 | WP_001320394.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO6_RS04045 | 830211..830854 | - | 644 | Protein_791 | antitoxin of toxin-antitoxin stability system | - |
| ECTO6_RS04050 | 830873..831094 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| ECTO6_RS04055 | 831157..831633 | - | 477 | WP_001347688.1 | RadC family protein | - |
| ECTO6_RS04060 | 831649..832134 | - | 486 | WP_029701480.1 | antirestriction protein | - |
| ECTO6_RS04065 | 832189..833007 | - | 819 | WP_001234642.1 | DUF945 domain-containing protein | - |
| ECTO6_RS04075 | 833107..833340 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| ECTO6_RS04080 | 833419..833874 | - | 456 | WP_000581493.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 827457..827561 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14059.10 Da Isoelectric Point: 9.2447
>T292705 WP_001094454.1 NZ_LS992166:c829703-829329 [Escherichia coli]
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13623.22 Da Isoelectric Point: 6.4783
>AT292705 WP_001320394.1 NZ_LS992166:c830161-829793 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
VSDTFSGTTHPDDNHDRPWWGLPSTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3P5UBZ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G8RJV8 |