Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2507867..2508517 | Replicon | chromosome |
Accession | NZ_LS991421 | ||
Organism | Lacticaseibacillus zeae isolate CECT 9104 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | DYY97_RS12195 | Protein ID | WP_005686631.1 |
Coordinates | 2507867..2508250 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0R1EMB2 |
Locus tag | DYY97_RS12200 | Protein ID | WP_010491246.1 |
Coordinates | 2508269..2508517 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY97_RS12175 | 2503212..2504219 | + | 1008 | WP_003662706.1 | L-lactate dehydrogenase | - |
DYY97_RS12180 | 2504526..2505896 | + | 1371 | WP_070650653.1 | L,D-transpeptidase/peptidoglycan binding protein | - |
DYY97_RS12185 | 2506111..2506776 | + | 666 | WP_010491258.1 | CBS domain-containing protein | - |
DYY97_RS12190 | 2507099..2507797 | + | 699 | WP_070650654.1 | L,D-transpeptidase | - |
DYY97_RS12195 | 2507867..2508250 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DYY97_RS12200 | 2508269..2508517 | - | 249 | WP_010491246.1 | antitoxin | Antitoxin |
DYY97_RS12205 | 2508616..2509755 | - | 1140 | WP_070650655.1 | alanine racemase | - |
DYY97_RS12210 | 2509742..2510116 | - | 375 | WP_039639939.1 | holo-ACP synthase | - |
DYY97_RS12215 | 2510354..2511862 | - | 1509 | WP_047107145.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T292701 WP_005686631.1 NZ_LS991421:c2508250-2507867 [Lacticaseibacillus zeae]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K8Q4Y0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R1EMB2 |