Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1565657..1566269 | Replicon | chromosome |
Accession | NZ_LS483522 | ||
Organism | Streptococcus pyogenes strain NCTC8224 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQN68_RS08130 | Protein ID | WP_002994716.1 |
Coordinates | 1565934..1566269 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQN68_RS08125 | Protein ID | WP_002988079.1 |
Coordinates | 1565657..1565944 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN68_RS08100 | 1560848..1561831 | - | 984 | WP_111702287.1 | tagatose-bisphosphate aldolase | - |
DQN68_RS08105 | 1561835..1562764 | - | 930 | WP_020837785.1 | tagatose-6-phosphate kinase | - |
DQN68_RS08110 | 1562810..1563325 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQN68_RS08115 | 1563360..1563788 | - | 429 | WP_002991702.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQN68_RS08120 | 1564234..1565007 | + | 774 | WP_023605292.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQN68_RS08125 | 1565657..1565944 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQN68_RS08130 | 1565934..1566269 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN68_RS09440 | 1566421..1566891 | + | 471 | WP_021733374.1 | site-specific integrase | - |
DQN68_RS09445 | 1566854..1567402 | + | 549 | WP_136115776.1 | site-specific integrase | - |
DQN68_RS08140 | 1567522..1567914 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQN68_RS08145 | 1567935..1568381 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQN68_RS08150 | 1568599..1568805 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQN68_RS08155 | 1568802..1569500 | - | 699 | WP_172453869.1 | hypothetical protein | - |
DQN68_RS08160 | 1569636..1570496 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQN68_RS08165 | 1570593..1571111 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292697 WP_002994716.1 NZ_LS483522:1565934-1566269 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|