Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1549046..1549658 | Replicon | chromosome |
Accession | NZ_LS483521 | ||
Organism | Streptococcus pyogenes strain NCTC8316 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQL26_RS07735 | Protein ID | WP_014635711.1 |
Coordinates | 1549323..1549658 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL26_RS07730 | Protein ID | WP_002988079.1 |
Coordinates | 1549046..1549333 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL26_RS07705 | 1544236..1545219 | - | 984 | WP_111693403.1 | tagatose-bisphosphate aldolase | - |
DQL26_RS07710 | 1545223..1546152 | - | 930 | WP_002988085.1 | tagatose-6-phosphate kinase | - |
DQL26_RS07715 | 1546198..1546713 | - | 516 | WP_023612880.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL26_RS07720 | 1546748..1547176 | - | 429 | WP_111693404.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL26_RS07725 | 1547623..1548396 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL26_RS07730 | 1549046..1549333 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL26_RS07735 | 1549323..1549658 | + | 336 | WP_014635711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL26_RS08960 | 1549809..1550279 | + | 471 | Protein_1418 | tyrosine-type recombinase/integrase family protein | - |
DQL26_RS07750 | 1550393..1550791 | + | 399 | WP_181879099.1 | tyrosine-type recombinase/integrase | - |
DQL26_RS07755 | 1550911..1551303 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL26_RS07760 | 1551324..1551770 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL26_RS07765 | 1551988..1552194 | - | 207 | WP_111693406.1 | helix-turn-helix transcriptional regulator | - |
DQL26_RS07770 | 1552191..1552889 | - | 699 | WP_161230228.1 | hypothetical protein | - |
DQL26_RS07775 | 1553025..1553885 | - | 861 | WP_011529009.1 | DegV family protein | - |
DQL26_RS07780 | 1553982..1554500 | - | 519 | WP_111693408.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13173.94 Da Isoelectric Point: 5.6809
>T292696 WP_014635711.1 NZ_LS483521:1549323-1549658 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|