Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1777727..1778213 | Replicon | chromosome |
| Accession | NZ_LS483520 | ||
| Organism | Streptococcus pyogenes strain NCTC8322 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q48QR0 |
| Locus tag | DQM49_RS09180 | Protein ID | WP_014407961.1 |
| Coordinates | 1777727..1777996 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A660A1J7 |
| Locus tag | DQM49_RS09185 | Protein ID | WP_014407962.1 |
| Coordinates | 1777986..1778213 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM49_RS09165 | 1773215..1774294 | + | 1080 | WP_020905593.1 | DUF4097 domain-containing protein | - |
| DQM49_RS09170 | 1774412..1776685 | - | 2274 | WP_021775373.1 | YhgE/Pip domain-containing protein | - |
| DQM49_RS09175 | 1776820..1777353 | + | 534 | WP_002982093.1 | TetR/AcrR family transcriptional regulator | - |
| DQM49_RS09180 | 1777727..1777996 | - | 270 | WP_014407961.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM49_RS09185 | 1777986..1778213 | - | 228 | WP_014407962.1 | hypothetical protein | Antitoxin |
| DQM49_RS09190 | 1778366..1778737 | - | 372 | WP_011285302.1 | DUF1492 domain-containing protein | - |
| DQM49_RS09195 | 1778727..1779074 | - | 348 | WP_011285303.1 | DUF1492 domain-containing protein | - |
| DQM49_RS09200 | 1779355..1779600 | - | 246 | WP_011285304.1 | hypothetical protein | - |
| DQM49_RS09205 | 1779575..1779850 | - | 276 | WP_014407964.1 | hypothetical protein | - |
| DQM49_RS09210 | 1779840..1780178 | - | 339 | WP_030126557.1 | replication protein | - |
| DQM49_RS09215 | 1780220..1780486 | - | 267 | WP_011285307.1 | hypothetical protein | - |
| DQM49_RS09220 | 1780483..1781271 | - | 789 | WP_011285308.1 | hypothetical protein | - |
| DQM49_RS09600 | 1781362..1781520 | - | 159 | WP_011285309.1 | hypothetical protein | - |
| DQM49_RS09225 | 1781534..1781779 | - | 246 | WP_011285310.1 | hypothetical protein | - |
| DQM49_RS09230 | 1781775..1782101 | - | 327 | Protein_1712 | hypothetical protein | - |
| DQM49_RS09605 | 1782103..1782276 | - | 174 | WP_011285312.1 | hypothetical protein | - |
| DQM49_RS09235 | 1782282..1782455 | - | 174 | WP_000694580.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10497.50 Da Isoelectric Point: 10.5027
>T292694 WP_014407961.1 NZ_LS483520:c1777996-1777727 [Streptococcus pyogenes]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A660A202 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A660A1J7 |