292694

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1777727..1778213 Replicon chromosome
Accession NZ_LS483520
Organism Streptococcus pyogenes strain NCTC8322

Toxin (Protein)


Gene name relE Uniprot ID Q48QR0
Locus tag DQM49_RS09180 Protein ID WP_014407961.1
Coordinates 1777727..1777996 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A660A1J7
Locus tag DQM49_RS09185 Protein ID WP_014407962.1
Coordinates 1777986..1778213 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM49_RS09165 1773215..1774294 + 1080 WP_020905593.1 DUF4097 domain-containing protein -
DQM49_RS09170 1774412..1776685 - 2274 WP_021775373.1 YhgE/Pip domain-containing protein -
DQM49_RS09175 1776820..1777353 + 534 WP_002982093.1 TetR/AcrR family transcriptional regulator -
DQM49_RS09180 1777727..1777996 - 270 WP_014407961.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM49_RS09185 1777986..1778213 - 228 WP_014407962.1 hypothetical protein Antitoxin
DQM49_RS09190 1778366..1778737 - 372 WP_011285302.1 DUF1492 domain-containing protein -
DQM49_RS09195 1778727..1779074 - 348 WP_011285303.1 DUF1492 domain-containing protein -
DQM49_RS09200 1779355..1779600 - 246 WP_011285304.1 hypothetical protein -
DQM49_RS09205 1779575..1779850 - 276 WP_014407964.1 hypothetical protein -
DQM49_RS09210 1779840..1780178 - 339 WP_030126557.1 replication protein -
DQM49_RS09215 1780220..1780486 - 267 WP_011285307.1 hypothetical protein -
DQM49_RS09220 1780483..1781271 - 789 WP_011285308.1 hypothetical protein -
DQM49_RS09600 1781362..1781520 - 159 WP_011285309.1 hypothetical protein -
DQM49_RS09225 1781534..1781779 - 246 WP_011285310.1 hypothetical protein -
DQM49_RS09230 1781775..1782101 - 327 Protein_1712 hypothetical protein -
DQM49_RS09605 1782103..1782276 - 174 WP_011285312.1 hypothetical protein -
DQM49_RS09235 1782282..1782455 - 174 WP_000694580.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10497.50 Da        Isoelectric Point: 10.5027

>T292694 WP_014407961.1 NZ_LS483520:c1777996-1777727 [Streptococcus pyogenes]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8641.63 Da        Isoelectric Point: 3.9607

>AT292694 WP_014407962.1 NZ_LS483520:c1778213-1777986 [Streptococcus pyogenes]
MAMVSLRLNSAEEELFRSYATHTGKTLSELFKTALAQQIEDQLDYETGIQALKRFEENPITYSIDDLIEELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A202

Antitoxin

Source ID Structure
AlphaFold DB A0A660A1J7

References