Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1615670..1616282 Replicon chromosome
Accession NZ_LS483520
Organism Streptococcus pyogenes strain NCTC8322

Toxin (Protein)


Gene name parE Uniprot ID Q1JEY4
Locus tag DQM49_RS08380 Protein ID WP_020905490.1
Coordinates 1615947..1616282 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM49_RS08375 Protein ID WP_002988079.1
Coordinates 1615670..1615957 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM49_RS08350 1610850..1611833 - 984 WP_020905487.1 tagatose-bisphosphate aldolase -
DQM49_RS08355 1611837..1612766 - 930 WP_020905488.1 tagatose-6-phosphate kinase -
DQM49_RS08360 1612812..1613327 - 516 WP_020905489.1 galactose-6-phosphate isomerase subunit LacB -
DQM49_RS08365 1613362..1613790 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQM49_RS08370 1614236..1615009 + 774 WP_011285171.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM49_RS08375 1615670..1615957 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM49_RS08380 1615947..1616282 + 336 WP_020905490.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM49_RS09620 1616434..1616904 + 471 Protein_1555 tyrosine-type recombinase/integrase family protein -
DQM49_RS09625 1617266..1617367 + 102 WP_180372495.1 hypothetical protein -
DQM49_RS08400 1617535..1617927 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM49_RS08405 1617948..1618394 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM49_RS08410 1618612..1618818 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQM49_RS08415 1618815..1619513 - 699 WP_021775254.1 hypothetical protein -
DQM49_RS08420 1619649..1620509 - 861 WP_020905495.1 DegV family protein -
DQM49_RS08425 1620606..1621124 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13147.98 Da        Isoelectric Point: 4.9405

>T292693 WP_020905490.1 NZ_LS483520:1615947-1616282 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIILYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292693 WP_002988079.1 NZ_LS483520:1615670-1615957 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q1JEY4

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References