Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1615670..1616282 | Replicon | chromosome |
Accession | NZ_LS483520 | ||
Organism | Streptococcus pyogenes strain NCTC8322 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q1JEY4 |
Locus tag | DQM49_RS08380 | Protein ID | WP_020905490.1 |
Coordinates | 1615947..1616282 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM49_RS08375 | Protein ID | WP_002988079.1 |
Coordinates | 1615670..1615957 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM49_RS08350 | 1610850..1611833 | - | 984 | WP_020905487.1 | tagatose-bisphosphate aldolase | - |
DQM49_RS08355 | 1611837..1612766 | - | 930 | WP_020905488.1 | tagatose-6-phosphate kinase | - |
DQM49_RS08360 | 1612812..1613327 | - | 516 | WP_020905489.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM49_RS08365 | 1613362..1613790 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM49_RS08370 | 1614236..1615009 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM49_RS08375 | 1615670..1615957 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM49_RS08380 | 1615947..1616282 | + | 336 | WP_020905490.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM49_RS09620 | 1616434..1616904 | + | 471 | Protein_1555 | tyrosine-type recombinase/integrase family protein | - |
DQM49_RS09625 | 1617266..1617367 | + | 102 | WP_180372495.1 | hypothetical protein | - |
DQM49_RS08400 | 1617535..1617927 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM49_RS08405 | 1617948..1618394 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM49_RS08410 | 1618612..1618818 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM49_RS08415 | 1618815..1619513 | - | 699 | WP_021775254.1 | hypothetical protein | - |
DQM49_RS08420 | 1619649..1620509 | - | 861 | WP_020905495.1 | DegV family protein | - |
DQM49_RS08425 | 1620606..1621124 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13147.98 Da Isoelectric Point: 4.9405
>T292693 WP_020905490.1 NZ_LS483520:1615947-1616282 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIILYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIILYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q1JEY4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |