Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Fic-relB/Fic-DinJ |
Location | 885616..886530 | Replicon | chromosome |
Accession | NZ_LS483510 | ||
Organism | Mycoplasma mycoides subsp. capri strain GM12 isolate synthetic |
Toxin (Protein)
Gene name | Fic | Uniprot ID | - |
Locus tag | EXZ31_RS03845 | Protein ID | WP_129880435.1 |
Coordinates | 885616..886173 (+) | Length | 186 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EXZ31_RS03850 | Protein ID | WP_129880436.1 |
Coordinates | 886258..886530 (+) | Length | 91 a.a. |
Genomic Context
Location: 885616..886173 (558 bp)
Type: Toxin
Protein ID: WP_129880435.1
Type: Toxin
Protein ID: WP_129880435.1
Location: 886258..886530 (273 bp)
Type: Antitoxin
Protein ID: WP_129880436.1
Type: Antitoxin
Protein ID: WP_129880436.1
Location: 888508..890547 (2040 bp)
Type: Others
Protein ID: WP_020862964.1
Type: Others
Protein ID: WP_020862964.1
Location: 882289..885254 (2966 bp)
Type: Others
Protein ID: Protein_699
Type: Others
Protein ID: Protein_699
Location: 886569..887310 (742 bp)
Type: Others
Protein ID: Protein_702
Type: Others
Protein ID: Protein_702
Location: 887303..888391 (1089 bp)
Type: Others
Protein ID: WP_020862963.1
Type: Others
Protein ID: WP_020862963.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EXZ31_RS03840 | 882289..885254 | - | 2966 | Protein_699 | viral A-type inclusion protein | - |
EXZ31_RS03845 | 885616..886173 | + | 558 | WP_129880435.1 | Fic family protein | Toxin |
EXZ31_RS03850 | 886258..886530 | + | 273 | WP_129880436.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EXZ31_RS03855 | 886569..887310 | - | 742 | Protein_702 | DNA adenine methylase | - |
EXZ31_RS03860 | 887303..888391 | - | 1089 | WP_020862963.1 | DNA adenine methylase | - |
EXZ31_RS03865 | 888508..890547 | + | 2040 | WP_020862964.1 | AlwI family type II restriction endonuclease | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 186 a.a. Molecular weight: 21402.77 Da Isoelectric Point: 7.8918
>T292682 WP_129880435.1 NZ_LS483510:885616-886173 [Mycoplasma mycoides subsp. capri]
MKANFLEEEFEINLSVKHLLELDKNLLNTFEIGTFKGLSQIHSYMFKDIFDFNGQIRNVNISKNNSMFCLARYLKQNLEI
IDNMKHDTFDQIIDKYVEMNICHPFREGNGRSMRILDLILKKQLNVVVNTNINKDEYLLAMINSLIDSTNLKLLIKNNLT
NKITDRNVYINNSFDIKNLKSF
MKANFLEEEFEINLSVKHLLELDKNLLNTFEIGTFKGLSQIHSYMFKDIFDFNGQIRNVNISKNNSMFCLARYLKQNLEI
IDNMKHDTFDQIIDKYVEMNICHPFREGNGRSMRILDLILKKQLNVVVNTNINKDEYLLAMINSLIDSTNLKLLIKNNLT
NKITDRNVYINNSFDIKNLKSF
Download Length: 558 bp