Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1972083..1972673 | Replicon | chromosome |
Accession | NZ_LS483499 | ||
Organism | Tatumella ptyseos strain NCTC11468 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A085JF07 |
Locus tag | DQM83_RS09685 | Protein ID | WP_029991547.1 |
Coordinates | 1972083..1972415 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A085JF06 |
Locus tag | DQM83_RS09690 | Protein ID | WP_029991546.1 |
Coordinates | 1972416..1972673 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM83_RS09655 | 1967396..1967770 | + | 375 | WP_029991550.1 | VOC family protein | - |
DQM83_RS09665 | 1968373..1969635 | + | 1263 | WP_029991549.1 | integrase arm-type DNA-binding domain-containing protein | - |
DQM83_RS09670 | 1970387..1971274 | - | 888 | WP_029991548.1 | integrase domain-containing protein | - |
DQM83_RS09685 | 1972083..1972415 | - | 333 | WP_029991547.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQM83_RS09690 | 1972416..1972673 | - | 258 | WP_029991546.1 | antitoxin | Antitoxin |
DQM83_RS09695 | 1973021..1973163 | - | 143 | Protein_1835 | helix-turn-helix domain-containing protein | - |
DQM83_RS09700 | 1973224..1973685 | - | 462 | WP_029991545.1 | hypothetical protein | - |
DQM83_RS09705 | 1974049..1976004 | + | 1956 | WP_029991543.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.51 Da Isoelectric Point: 9.3429
>T292670 WP_029991547.1 NZ_LS483499:c1972415-1972083 [Tatumella ptyseos]
MDRGEIWLVSLDPVAGHEQSGKRPVLIVSPASFNKLTRLPVVVPVTSGGNFARAAGFAVSLDGAGTKTAGIIRCDQPRTI
DMAARNGKRLEQIPDSIVNEVLARLEAILN
MDRGEIWLVSLDPVAGHEQSGKRPVLIVSPASFNKLTRLPVVVPVTSGGNFARAAGFAVSLDGAGTKTAGIIRCDQPRTI
DMAARNGKRLEQIPDSIVNEVLARLEAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085JF07 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085JF06 |