Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 990957..991573 Replicon chromosome
Accession NZ_LS483499
Organism Tatumella ptyseos strain NCTC11468

Toxin (Protein)


Gene name Hha Uniprot ID A0A085JB64
Locus tag DQM83_RS04790 Protein ID WP_025902459.1
Coordinates 990957..991175 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A085JB63
Locus tag DQM83_RS04795 Protein ID WP_029990846.1
Coordinates 991193..991573 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM83_RS04755 986617..986955 + 339 WP_025902464.1 P-II family nitrogen regulator -
DQM83_RS04760 986987..988272 + 1286 Protein_903 ammonium transporter AmtB -
DQM83_RS04770 988481..988939 + 459 WP_111678440.1 IS200/IS605 family transposase -
DQM83_RS04775 989584..990063 + 480 WP_025902461.1 YbaY family lipoprotein -
DQM83_RS04780 990085..990402 - 318 WP_025902460.1 MGMT family protein -
DQM83_RS04790 990957..991175 - 219 WP_025902459.1 hemolysin expression modulator Hha Toxin
DQM83_RS04795 991193..991573 - 381 WP_029990846.1 Hha toxicity modulator TomB Antitoxin
DQM83_RS04800 992283..992957 + 675 WP_029990844.1 ABC transporter ATP-binding protein -
DQM83_RS04805 992948..993792 + 845 Protein_910 metal ABC transporter permease -
DQM83_RS04810 993811..994689 + 879 WP_029990842.1 zinc ABC transporter substrate-binding protein -
DQM83_RS04815 994753..994938 - 186 WP_197709877.1 50S ribosomal protein L36 -
DQM83_RS04820 994942..995205 - 264 WP_025902453.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 988481..988939 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-117)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.99 Da        Isoelectric Point: 8.8662

>T292669 WP_025902459.1 NZ_LS483499:c991175-990957 [Tatumella ptyseos]
MSQTPLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDEDLVVFYSAADHRLAELTMNKLYDKVPATVWKYVR

Download         Length: 219 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 14703.51 Da        Isoelectric Point: 4.2332

>AT292669 WP_029990846.1 NZ_LS483499:c991573-991193 [Tatumella ptyseos]
MDEYSPKRYDVAQLKFLCENLFDESLATLNLQELCWINDPTSIENLQLHDLIEHIAAVSIIYKLKHSEDELLISQVDKYL
DDTFTLFSGYTVNEQDLNYWKASSNKLFRLFFEASLCQESGQSLTH

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A085JB64

Antitoxin

Source ID Structure
AlphaFold DB A0A085JB63

References