Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 990957..991573 | Replicon | chromosome |
Accession | NZ_LS483499 | ||
Organism | Tatumella ptyseos strain NCTC11468 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085JB64 |
Locus tag | DQM83_RS04790 | Protein ID | WP_025902459.1 |
Coordinates | 990957..991175 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085JB63 |
Locus tag | DQM83_RS04795 | Protein ID | WP_029990846.1 |
Coordinates | 991193..991573 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM83_RS04755 | 986617..986955 | + | 339 | WP_025902464.1 | P-II family nitrogen regulator | - |
DQM83_RS04760 | 986987..988272 | + | 1286 | Protein_903 | ammonium transporter AmtB | - |
DQM83_RS04770 | 988481..988939 | + | 459 | WP_111678440.1 | IS200/IS605 family transposase | - |
DQM83_RS04775 | 989584..990063 | + | 480 | WP_025902461.1 | YbaY family lipoprotein | - |
DQM83_RS04780 | 990085..990402 | - | 318 | WP_025902460.1 | MGMT family protein | - |
DQM83_RS04790 | 990957..991175 | - | 219 | WP_025902459.1 | hemolysin expression modulator Hha | Toxin |
DQM83_RS04795 | 991193..991573 | - | 381 | WP_029990846.1 | Hha toxicity modulator TomB | Antitoxin |
DQM83_RS04800 | 992283..992957 | + | 675 | WP_029990844.1 | ABC transporter ATP-binding protein | - |
DQM83_RS04805 | 992948..993792 | + | 845 | Protein_910 | metal ABC transporter permease | - |
DQM83_RS04810 | 993811..994689 | + | 879 | WP_029990842.1 | zinc ABC transporter substrate-binding protein | - |
DQM83_RS04815 | 994753..994938 | - | 186 | WP_197709877.1 | 50S ribosomal protein L36 | - |
DQM83_RS04820 | 994942..995205 | - | 264 | WP_025902453.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 988481..988939 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.99 Da Isoelectric Point: 8.8662
>T292669 WP_025902459.1 NZ_LS483499:c991175-990957 [Tatumella ptyseos]
MSQTPLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDEDLVVFYSAADHRLAELTMNKLYDKVPATVWKYVR
MSQTPLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDEDLVVFYSAADHRLAELTMNKLYDKVPATVWKYVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14703.51 Da Isoelectric Point: 4.2332
>AT292669 WP_029990846.1 NZ_LS483499:c991573-991193 [Tatumella ptyseos]
MDEYSPKRYDVAQLKFLCENLFDESLATLNLQELCWINDPTSIENLQLHDLIEHIAAVSIIYKLKHSEDELLISQVDKYL
DDTFTLFSGYTVNEQDLNYWKASSNKLFRLFFEASLCQESGQSLTH
MDEYSPKRYDVAQLKFLCENLFDESLATLNLQELCWINDPTSIENLQLHDLIEHIAAVSIIYKLKHSEDELLISQVDKYL
DDTFTLFSGYTVNEQDLNYWKASSNKLFRLFFEASLCQESGQSLTH
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085JB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085JB63 |