Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3740593..3741410 | Replicon | chromosome |
Accession | NZ_LS483498 | ||
Organism | Morganella morganii strain NCTC12028 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A2C5TM43 |
Locus tag | DQM84_RS18060 | Protein ID | WP_004236532.1 |
Coordinates | 3740593..3741075 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | J7TDK6 |
Locus tag | DQM84_RS18065 | Protein ID | WP_004236533.1 |
Coordinates | 3741102..3741410 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM84_RS18030 | 3735957..3736580 | - | 624 | WP_004236525.1 | thiol:disulfide interchange protein DsbA | - |
DQM84_RS18035 | 3736599..3737594 | - | 996 | WP_004236526.1 | serine/threonine protein kinase | - |
DQM84_RS18040 | 3737594..3737863 | - | 270 | WP_004240741.1 | YihD family protein | - |
DQM84_RS18045 | 3738066..3739181 | + | 1116 | WP_004236528.1 | molybdenum cofactor guanylyltransferase MobA | - |
DQM84_RS18050 | 3739391..3739693 | + | 303 | WP_004236529.1 | ABC transporter substrate-binding protein | - |
DQM84_RS18055 | 3739821..3740342 | + | 522 | WP_015422407.1 | isopentenyl-diphosphate Delta-isomerase | - |
DQM84_RS19145 | 3740339..3740479 | + | 141 | WP_004236531.1 | hypothetical protein | - |
DQM84_RS18060 | 3740593..3741075 | - | 483 | WP_004236532.1 | GNAT family N-acetyltransferase | Toxin |
DQM84_RS18065 | 3741102..3741410 | - | 309 | WP_004236533.1 | DUF1778 domain-containing protein | Antitoxin |
DQM84_RS18070 | 3741542..3742894 | - | 1353 | WP_004236534.1 | glutathione-disulfide reductase | - |
DQM84_RS18075 | 3742964..3743806 | - | 843 | WP_004236535.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
DQM84_RS18080 | 3743996..3744385 | + | 390 | WP_004236536.1 | DUF1090 domain-containing protein | - |
DQM84_RS18085 | 3744797..3745789 | + | 993 | WP_004236539.1 | inner membrane protein YhjD | - |
DQM84_RS18090 | 3745897..3746103 | + | 207 | WP_004236540.1 | 4-oxalocrotonate tautomerase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17729.48 Da Isoelectric Point: 10.2370
>T292668 WP_004236532.1 NZ_LS483498:c3741075-3740593 [Morganella morganii]
MQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPEIPVILPGR
LAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQLATGIYSE
MQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPEIPVILPGR
LAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQLATGIYSE
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2C5TM43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | J7TDK6 |